Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4174457..4174715 | Replicon | chromosome |
Accession | NZ_CP126942 | ||
Organism | Escherichia coli O1:K1:H7 strain APEC E18006 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | QQA29_RS20630 | Protein ID | WP_000809168.1 |
Coordinates | 4174563..4174715 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4174457..4174514 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA29_RS20615 | 4170289..4171548 | - | 1260 | WP_000494924.1 | hypothetical protein | - |
QQA29_RS20620 | 4171677..4173170 | - | 1494 | WP_001350775.1 | sulfatase-like hydrolase/transferase | - |
QQA29_RS20625 | 4173190..4173951 | - | 762 | WP_001274823.1 | outer membrane protein OmpK | - |
- | 4174457..4174514 | - | 58 | - | - | Antitoxin |
QQA29_RS20630 | 4174563..4174715 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
QQA29_RS20635 | 4174820..4175950 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
QQA29_RS20640 | 4176039..4177955 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
QQA29_RS20645 | 4178327..4178731 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
QQA29_RS20650 | 4178757..4179470 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T283213 WP_000809168.1 NZ_CP126942:4174563-4174715 [Escherichia coli O1:K1:H7]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT283213 NZ_CP126942:c4174514-4174457 [Escherichia coli O1:K1:H7]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|