Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3905394..3906088 | Replicon | chromosome |
Accession | NZ_CP126942 | ||
Organism | Escherichia coli O1:K1:H7 strain APEC E18006 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | QQA29_RS19380 | Protein ID | WP_001263500.1 |
Coordinates | 3905394..3905792 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QQA29_RS19385 | Protein ID | WP_000554758.1 |
Coordinates | 3905795..3906088 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA29_RS19355 (3900759) | 3900759..3901217 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
QQA29_RS19360 (3901478) | 3901478..3902935 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
QQA29_RS19365 (3902992) | 3902992..3903606 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
QQA29_RS19370 (3903603) | 3903603..3904742 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
QQA29_RS19375 (3904932) | 3904932..3905384 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
QQA29_RS19380 (3905394) | 3905394..3905792 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QQA29_RS19385 (3905795) | 3905795..3906088 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QQA29_RS19390 (3906140) | 3906140..3907195 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
QQA29_RS19395 (3907266) | 3907266..3908051 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
QQA29_RS19400 (3908023) | 3908023..3909735 | + | 1713 | Protein_3804 | flagellar biosynthesis protein FlhA | - |
QQA29_RS19405 (3909814) | 3909814..3909972 | + | 159 | WP_014639450.1 | hypothetical protein | - |
QQA29_RS19410 (3910055) | 3910055..3910552 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3905394..3925748 | 20354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T283212 WP_001263500.1 NZ_CP126942:c3905792-3905394 [Escherichia coli O1:K1:H7]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|