Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3663611..3664290 | Replicon | chromosome |
Accession | NZ_CP126942 | ||
Organism | Escherichia coli O1:K1:H7 strain APEC E18006 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0VBP6 |
Locus tag | QQA29_RS18235 | Protein ID | WP_000057524.1 |
Coordinates | 3663988..3664290 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QQA29_RS18230 | Protein ID | WP_000806442.1 |
Coordinates | 3663611..3663952 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA29_RS18220 (3659855) | 3659855..3660787 | - | 933 | WP_000883052.1 | glutaminase A | - |
QQA29_RS18225 (3661049) | 3661049..3663553 | + | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
QQA29_RS18230 (3663611) | 3663611..3663952 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QQA29_RS18235 (3663988) | 3663988..3664290 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQA29_RS18240 (3664423) | 3664423..3665217 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
QQA29_RS18245 (3665421) | 3665421..3665900 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QQA29_RS18250 (3665924) | 3665924..3666724 | + | 801 | WP_000439796.1 | hypothetical protein | - |
QQA29_RS18255 (3666721) | 3666721..3667224 | + | 504 | WP_000667000.1 | hypothetical protein | - |
QQA29_RS18260 (3667262) | 3667262..3668914 | - | 1653 | WP_080282699.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3656300..3667224 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T283210 WP_000057524.1 NZ_CP126942:c3664290-3663988 [Escherichia coli O1:K1:H7]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT283210 WP_000806442.1 NZ_CP126942:c3663952-3663611 [Escherichia coli O1:K1:H7]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|