Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 154708..154962 | Replicon | plasmid pEND_Eco 18055 |
| Accession | NZ_CP126941 | ||
| Organism | Escherichia coli O2:K1:H7 strain APEC E18055 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QQA30_RS26135 | Protein ID | WP_001312851.1 |
| Coordinates | 154708..154857 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 154901..154962 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA30_RS26090 (150251) | 150251..150598 | + | 348 | Protein_150 | IS1-like element IS1A family transposase | - |
| QQA30_RS26095 (150614) | 150614..150934 | - | 321 | Protein_151 | serine acetyltransferase | - |
| QQA30_RS26100 (151038) | 151038..151325 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QQA30_RS26105 (151322) | 151322..151573 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QQA30_RS26110 (152536) | 152536..153393 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| QQA30_RS26115 (153386) | 153386..153868 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| QQA30_RS26120 (153861) | 153861..153908 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| QQA30_RS26125 (153899) | 153899..154150 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| QQA30_RS26130 (154167) | 154167..154424 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QQA30_RS26135 (154708) | 154708..154857 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (154901) | 154901..154962 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (154901) | 154901..154962 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (154901) | 154901..154962 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (154901) | 154901..154962 | + | 62 | NuclAT_1 | - | Antitoxin |
| QQA30_RS26140 (155218) | 155218..155292 | - | 75 | Protein_160 | endonuclease | - |
| QQA30_RS26145 (155538) | 155538..155750 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| QQA30_RS26150 (155886) | 155886..156446 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| QQA30_RS26155 (156549) | 156549..157409 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| QQA30_RS26160 (157468) | 157468..158214 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..199896 | 199896 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T283191 WP_001312851.1 NZ_CP126941:c154857-154708 [Escherichia coli O2:K1:H7]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT283191 NZ_CP126941:154901-154962 [Escherichia coli O2:K1:H7]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|