Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3951205..3951899 | Replicon | chromosome |
| Accession | NZ_CP126940 | ||
| Organism | Escherichia coli O2:K1:H7 strain APEC E18055 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | QQA30_RS19635 | Protein ID | WP_001263500.1 |
| Coordinates | 3951205..3951603 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QQA30_RS19640 | Protein ID | WP_000554758.1 |
| Coordinates | 3951606..3951899 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA30_RS19610 (3946570) | 3946570..3947028 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
| QQA30_RS19615 (3947289) | 3947289..3948746 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| QQA30_RS19620 (3948803) | 3948803..3949417 | - | 615 | WP_231528506.1 | peptide chain release factor H | - |
| QQA30_RS19625 (3949414) | 3949414..3950553 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
| QQA30_RS19630 (3950743) | 3950743..3951195 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| QQA30_RS19635 (3951205) | 3951205..3951603 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QQA30_RS19640 (3951606) | 3951606..3951899 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QQA30_RS19645 (3951951) | 3951951..3953006 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| QQA30_RS19650 (3953077) | 3953077..3953862 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
| QQA30_RS19655 (3953834) | 3953834..3955546 | + | 1713 | Protein_3853 | flagellar biosynthesis protein FlhA | - |
| QQA30_RS19660 (3955625) | 3955625..3955783 | + | 159 | WP_014639450.1 | hypothetical protein | - |
| QQA30_RS19665 (3955866) | 3955866..3956363 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3951205..3971559 | 20354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T283183 WP_001263500.1 NZ_CP126940:c3951603-3951205 [Escherichia coli O2:K1:H7]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|