Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4689381..4689983 | Replicon | chromosome |
| Accession | NZ_CP126937 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E19019 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QQA31_RS22800 | Protein ID | WP_000897302.1 |
| Coordinates | 4689672..4689983 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QQA31_RS22795 | Protein ID | WP_000356397.1 |
| Coordinates | 4689381..4689671 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA31_RS22770 (4685454) | 4685454..4686356 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QQA31_RS22775 (4686353) | 4686353..4686988 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QQA31_RS22780 (4686985) | 4686985..4687914 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| QQA31_RS22785 (4688130) | 4688130..4688348 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| QQA31_RS22790 (4688744) | 4688744..4689022 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| QQA31_RS22795 (4689381) | 4689381..4689671 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QQA31_RS22800 (4689672) | 4689672..4689983 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QQA31_RS22805 (4690212) | 4690212..4691120 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| QQA31_RS22810 (4691184) | 4691184..4692125 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QQA31_RS22815 (4692170) | 4692170..4692607 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QQA31_RS22820 (4692604) | 4692604..4693476 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QQA31_RS22825 (4693470) | 4693470..4694069 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T283168 WP_000897302.1 NZ_CP126937:c4689983-4689672 [Escherichia coli O2:K1:H4]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|