Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4030119..4030377 | Replicon | chromosome |
Accession | NZ_CP126937 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E19019 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | QQA31_RS19655 | Protein ID | WP_000809168.1 |
Coordinates | 4030225..4030377 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4030119..4030176 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA31_RS19640 | 4025951..4027210 | - | 1260 | WP_000494924.1 | hypothetical protein | - |
QQA31_RS19645 | 4027339..4028832 | - | 1494 | WP_001350775.1 | sulfatase-like hydrolase/transferase | - |
QQA31_RS19650 | 4028852..4029613 | - | 762 | WP_001274823.1 | outer membrane protein OmpK | - |
- | 4030119..4030176 | - | 58 | - | - | Antitoxin |
QQA31_RS19655 | 4030225..4030377 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
QQA31_RS19660 | 4030482..4031612 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
QQA31_RS19665 | 4031701..4033617 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
QQA31_RS19670 | 4033989..4034393 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
QQA31_RS19675 | 4034419..4035132 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T283161 WP_000809168.1 NZ_CP126937:4030225-4030377 [Escherichia coli O2:K1:H4]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT283161 NZ_CP126937:c4030176-4030119 [Escherichia coli O2:K1:H4]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|