Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3761106..3761800 | Replicon | chromosome |
| Accession | NZ_CP126937 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E19019 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | QQA31_RS18405 | Protein ID | WP_001263500.1 |
| Coordinates | 3761106..3761504 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QQA31_RS18410 | Protein ID | WP_000554758.1 |
| Coordinates | 3761507..3761800 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA31_RS18380 (3756471) | 3756471..3756929 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
| QQA31_RS18385 (3757190) | 3757190..3758647 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| QQA31_RS18390 (3758704) | 3758704..3759318 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| QQA31_RS18395 (3759315) | 3759315..3760454 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
| QQA31_RS18400 (3760644) | 3760644..3761096 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| QQA31_RS18405 (3761106) | 3761106..3761504 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QQA31_RS18410 (3761507) | 3761507..3761800 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QQA31_RS18415 (3761852) | 3761852..3762907 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| QQA31_RS18420 (3762978) | 3762978..3763763 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
| QQA31_RS18425 (3763735) | 3763735..3765447 | + | 1713 | Protein_3611 | flagellar biosynthesis protein FlhA | - |
| QQA31_RS18430 (3765526) | 3765526..3765684 | + | 159 | WP_014639450.1 | hypothetical protein | - |
| QQA31_RS18435 (3765767) | 3765767..3766264 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3761106..3781459 | 20353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T283160 WP_001263500.1 NZ_CP126937:c3761504-3761106 [Escherichia coli O2:K1:H4]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|