Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3497124..3497803 | Replicon | chromosome |
| Accession | NZ_CP126937 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E19019 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0VBP6 |
| Locus tag | QQA31_RS17110 | Protein ID | WP_000057524.1 |
| Coordinates | 3497501..3497803 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QQA31_RS17105 | Protein ID | WP_000806442.1 |
| Coordinates | 3497124..3497465 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA31_RS17095 (3493368) | 3493368..3494300 | - | 933 | WP_000883052.1 | glutaminase A | - |
| QQA31_RS17100 (3494562) | 3494562..3497066 | + | 2505 | WP_016239198.1 | copper-exporting P-type ATPase CopA | - |
| QQA31_RS17105 (3497124) | 3497124..3497465 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QQA31_RS17110 (3497501) | 3497501..3497803 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQA31_RS17115 (3497936) | 3497936..3498730 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
| QQA31_RS17120 (3498934) | 3498934..3499413 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QQA31_RS17125 (3499437) | 3499437..3500237 | + | 801 | WP_000439796.1 | hypothetical protein | - |
| QQA31_RS17130 (3500234) | 3500234..3500737 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| QQA31_RS17135 (3500775) | 3500775..3502427 | - | 1653 | WP_001513633.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3489813..3500737 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T283158 WP_000057524.1 NZ_CP126937:c3497803-3497501 [Escherichia coli O2:K1:H4]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT283158 WP_000806442.1 NZ_CP126937:c3497465-3497124 [Escherichia coli O2:K1:H4]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|