Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2507030..2507592 | Replicon | chromosome |
Accession | NZ_CP126937 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E19019 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1Q1V8 |
Locus tag | QQA31_RS12185 | Protein ID | WP_000605675.1 |
Coordinates | 2507030..2507308 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1PAQ1 |
Locus tag | QQA31_RS12190 | Protein ID | WP_000781370.1 |
Coordinates | 2507308..2507592 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA31_RS12160 (2502617) | 2502617..2503048 | - | 432 | WP_000152310.1 | peroxiredoxin OsmC | - |
QQA31_RS12165 (2503393) | 2503393..2503608 | + | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
QQA31_RS12170 (2503710) | 2503710..2503847 | + | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
QQA31_RS12175 (2504003) | 2504003..2505700 | + | 1698 | WP_000433462.1 | malate dehydrogenase | - |
QQA31_RS12180 (2505834) | 2505834..2506844 | + | 1011 | WP_000642412.1 | alcohol dehydrogenase AdhP | - |
QQA31_RS12185 (2507030) | 2507030..2507308 | + | 279 | WP_000605675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQA31_RS12190 (2507308) | 2507308..2507592 | + | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
QQA31_RS12195 (2507821) | 2507821..2508474 | - | 654 | WP_000045647.1 | formate dehydrogenase-N subunit gamma | - |
QQA31_RS12200 (2508467) | 2508467..2509351 | - | 885 | WP_001240584.1 | formate dehydrogenase N subunit beta | - |
QQA31_RS12205 (2509364) | 2509364..2512411 | - | 3048 | WP_011478186.1 | formate dehydrogenase-N subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10537.16 Da Isoelectric Point: 7.3206
>T283157 WP_000605675.1 NZ_CP126937:2507030-2507308 [Escherichia coli O2:K1:H4]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1Q1V8 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2ICT | |
PDB | 2ICP | |
AlphaFold DB | A0A829CUG6 |