Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 215963..216185 | Replicon | chromosome |
Accession | NZ_CP126937 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E19019 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | QQA31_RS01085 | Protein ID | WP_001295224.1 |
Coordinates | 216078..216185 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 215963..216021 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA31_RS01060 | 211352..212335 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
QQA31_RS01065 | 212332..213336 | + | 1005 | WP_000103579.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QQA31_RS01070 | 213366..214637 | - | 1272 | WP_001332306.1 | aromatic amino acid transport family protein | - |
QQA31_RS01075 | 215113..215220 | + | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QQA31_RS01080 | 215595..215702 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 215963..216021 | - | 59 | - | - | Antitoxin |
QQA31_RS01085 | 216078..216185 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
QQA31_RS01090 | 216271..217950 | - | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
QQA31_RS01095 | 217947..218138 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
QQA31_RS01100 | 218135..219706 | - | 1572 | WP_001204957.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
QQA31_RS01105 | 219979..220167 | + | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
QQA31_RS01110 | 220179..220931 | + | 753 | WP_000279545.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T283145 WP_001295224.1 NZ_CP126937:216078-216185 [Escherichia coli O2:K1:H4]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 59 bp
>AT283145 NZ_CP126937:c216021-215963 [Escherichia coli O2:K1:H4]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|