Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 64435..64704 | Replicon | plasmid pEND_Eco19057-2 |
Accession | NZ_CP126936 | ||
Organism | Escherichia coli O78:H4 strain APEC E19057 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | QQA26_RS24925 | Protein ID | WP_001372321.1 |
Coordinates | 64579..64704 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 64435..64500 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA26_RS24870 | 59697..60668 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
QQA26_RS24875 | 61262..61431 | + | 170 | Protein_50 | hypothetical protein | - |
QQA26_RS24880 | 61614..61694 | - | 81 | Protein_51 | hypothetical protein | - |
QQA26_RS24885 | 61764..61970 | + | 207 | WP_000275856.1 | hypothetical protein | - |
QQA26_RS24890 | 61996..62535 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
QQA26_RS24895 | 62603..62836 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
QQA26_RS24900 | 62864..63061 | + | 198 | Protein_55 | hypothetical protein | - |
QQA26_RS24905 | 63116..63550 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
QQA26_RS24910 | 63547..64309 | + | 763 | Protein_57 | plasmid SOS inhibition protein A | - |
QQA26_RS24915 | 64278..64466 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 64278..64502 | + | 225 | NuclAT_0 | - | - |
- | 64278..64502 | + | 225 | NuclAT_0 | - | - |
- | 64278..64502 | + | 225 | NuclAT_0 | - | - |
- | 64278..64502 | + | 225 | NuclAT_0 | - | - |
- | 64435..64500 | - | 66 | - | - | Antitoxin |
QQA26_RS24920 | 64488..64637 | + | 150 | Protein_59 | plasmid maintenance protein Mok | - |
QQA26_RS24925 | 64579..64704 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
QQA26_RS24930 | 64924..65154 | + | 231 | WP_071586998.1 | hypothetical protein | - |
QQA26_RS24935 | 65152..65324 | - | 173 | Protein_62 | hypothetical protein | - |
QQA26_RS24940 | 65394..65600 | + | 207 | WP_000547968.1 | hypothetical protein | - |
QQA26_RS24945 | 65625..65912 | + | 288 | WP_000107535.1 | hypothetical protein | - |
QQA26_RS24950 | 66030..66851 | + | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
QQA26_RS24955 | 67148..67738 | - | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
QQA26_RS24960 | 68071..68454 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
QQA26_RS24965 | 68641..69330 | + | 690 | WP_015918718.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat | 1..104962 | 104962 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T283137 WP_001372321.1 NZ_CP126936:64579-64704 [Escherichia coli O78:H4]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT283137 NZ_CP126936:c64500-64435 [Escherichia coli O78:H4]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|