Detailed information of TA system TA283137

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 64435..64704
• Replicon: plasmid pEND_Eco19057-2
• Accession: NZ_CP126936
• Organism: Escherichia coli O78:H4 strain APEC E19057

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQA26_RS24925
• Protein ID: WP_001372321.1
• Coordinates: 64579..64704 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	64435..64500 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQA26_RS24870	59697..60668	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
QQA26_RS24875	61262..61431	+	170	Protein_50	hypothetical protein	-
QQA26_RS24880	61614..61694	-	81	Protein_51	hypothetical protein	-
QQA26_RS24885	61764..61970	+	207	WP_000275856.1	hypothetical protein	-
QQA26_RS24890	61996..62535	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
QQA26_RS24895	62603..62836	+	234	WP_000005990.1	DUF905 family protein	-
QQA26_RS24900	62864..63061	+	198	Protein_55	hypothetical protein	-
QQA26_RS24905	63116..63550	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
QQA26_RS24910	63547..64309	+	763	Protein_57	plasmid SOS inhibition protein A	-
QQA26_RS24915	64278..64466	-	189	WP_001299721.1	hypothetical protein	-
-	64278..64502	+	225	NuclAT_0	-	-
-	64278..64502	+	225	NuclAT_0	-	-
-	64278..64502	+	225	NuclAT_0	-	-
-	64278..64502	+	225	NuclAT_0	-	-
-	64435..64500	-	66	-	-	Antitoxin
QQA26_RS24920	64488..64637	+	150	Protein_59	plasmid maintenance protein Mok	-
QQA26_RS24925	64579..64704	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQA26_RS24930	64924..65154	+	231	WP_071586998.1	hypothetical protein	-
QQA26_RS24935	65152..65324	-	173	Protein_62	hypothetical protein	-
QQA26_RS24940	65394..65600	+	207	WP_000547968.1	hypothetical protein	-
QQA26_RS24945	65625..65912	+	288	WP_000107535.1	hypothetical protein	-
QQA26_RS24950	66030..66851	+	822	WP_001234426.1	DUF932 domain-containing protein	-
QQA26_RS24955	67148..67738	-	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
QQA26_RS24960	68071..68454	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QQA26_RS24965	68641..69330	+	690	WP_015918718.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	sitABCD	iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat	1..104962	104962

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T283137 WP_001372321.1 NZ_CP126936:64579-64704 [Escherichia coli O78:H4]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT283137 NZ_CP126936:c64500-64435 [Escherichia coli O78:H4]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin