Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 19016..19280 Replicon plasmid pEND_Eco19057-1
Accession NZ_CP126935
Organism Escherichia coli O78:H4 strain APEC E19057

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag QQA26_RS24120 Protein ID WP_001387489.1
Coordinates 19128..19280 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 19016..19078 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA26_RS24105 (14255) 14255..16546 - 2292 WP_072742854.1 F-type conjugative transfer protein TrbC -
QQA26_RS24110 (16539) 16539..17609 - 1071 WP_039005625.1 IncI1-type conjugal transfer protein TrbB -
QQA26_RS24115 (17628) 17628..18836 - 1209 WP_039005623.1 IncI1-type conjugal transfer protein TrbA -
- (19016) 19016..19078 - 63 NuclAT_0 - Antitoxin
- (19016) 19016..19078 - 63 NuclAT_0 - Antitoxin
- (19016) 19016..19078 - 63 NuclAT_0 - Antitoxin
- (19016) 19016..19078 - 63 NuclAT_0 - Antitoxin
QQA26_RS24120 (19128) 19128..19280 + 153 WP_001387489.1 Hok/Gef family protein Toxin
QQA26_RS24125 (19352) 19352..19603 - 252 WP_001291964.1 hypothetical protein -
QQA26_RS24130 (20102) 20102..20197 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QQA26_RS24135 (20262) 20262..20438 - 177 WP_001054898.1 hypothetical protein -
QQA26_RS24140 (20830) 20830..21039 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QQA26_RS24145 (21111) 21111..21761 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
QQA26_RS24150 (21835) 21835..24003 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - afaC-I 1..110406 110406


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T283131 WP_001387489.1 NZ_CP126935:19128-19280 [Escherichia coli O78:H4]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT283131 NZ_CP126935:c19078-19016 [Escherichia coli O78:H4]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References