Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 19016..19280 | Replicon | plasmid pEND_Eco19057-1 |
| Accession | NZ_CP126935 | ||
| Organism | Escherichia coli O78:H4 strain APEC E19057 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | QQA26_RS24120 | Protein ID | WP_001387489.1 |
| Coordinates | 19128..19280 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 19016..19078 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA26_RS24105 (14255) | 14255..16546 | - | 2292 | WP_072742854.1 | F-type conjugative transfer protein TrbC | - |
| QQA26_RS24110 (16539) | 16539..17609 | - | 1071 | WP_039005625.1 | IncI1-type conjugal transfer protein TrbB | - |
| QQA26_RS24115 (17628) | 17628..18836 | - | 1209 | WP_039005623.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (19016) | 19016..19078 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (19016) | 19016..19078 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (19016) | 19016..19078 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (19016) | 19016..19078 | - | 63 | NuclAT_0 | - | Antitoxin |
| QQA26_RS24120 (19128) | 19128..19280 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| QQA26_RS24125 (19352) | 19352..19603 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| QQA26_RS24130 (20102) | 20102..20197 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| QQA26_RS24135 (20262) | 20262..20438 | - | 177 | WP_001054898.1 | hypothetical protein | - |
| QQA26_RS24140 (20830) | 20830..21039 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QQA26_RS24145 (21111) | 21111..21761 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QQA26_RS24150 (21835) | 21835..24003 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | afaC-I | 1..110406 | 110406 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T283131 WP_001387489.1 NZ_CP126935:19128-19280 [Escherichia coli O78:H4]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT283131 NZ_CP126935:c19078-19016 [Escherichia coli O78:H4]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|