Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3006216..3007015 | Replicon | chromosome |
Accession | NZ_CP126934 | ||
Organism | Escherichia coli O78:H4 strain APEC E19057 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | QQA26_RS15025 | Protein ID | WP_000347251.1 |
Coordinates | 3006551..3007015 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QQA26_RS15020 | Protein ID | WP_001307405.1 |
Coordinates | 3006216..3006551 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA26_RS15005 (3002001) | 3002001..3002771 | - | 771 | WP_001058214.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
QQA26_RS15010 (3002787) | 3002787..3004121 | - | 1335 | WP_000599652.1 | galactarate/glucarate/glycerate transporter GarP | - |
QQA26_RS15015 (3004496) | 3004496..3006067 | + | 1572 | WP_001273761.1 | galactarate dehydratase | - |
QQA26_RS15020 (3006216) | 3006216..3006551 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QQA26_RS15025 (3006551) | 3006551..3007015 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QQA26_RS15030 (3007070) | 3007070..3007879 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QQA26_RS15035 (3008128) | 3008128..3009408 | + | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QQA26_RS15040 (3009431) | 3009431..3009904 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QQA26_RS15045 (3009915) | 3009915..3010694 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QQA26_RS15050 (3010684) | 3010684..3011562 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QQA26_RS15055 (3011580) | 3011580..3012014 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2995341..3007015 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T283125 WP_000347251.1 NZ_CP126934:3006551-3007015 [Escherichia coli O78:H4]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |