Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 2887178..2887871 | Replicon | chromosome |
| Accession | NZ_CP126934 | ||
| Organism | Escherichia coli O78:H4 strain APEC E19057 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | QQA26_RS14440 | Protein ID | WP_000415584.1 |
| Coordinates | 2887575..2887871 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | QQA26_RS14435 | Protein ID | WP_000650107.1 |
| Coordinates | 2887178..2887573 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA26_RS14425 (2883042) | 2883042..2885300 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
| QQA26_RS14430 (2885438) | 2885438..2887045 | - | 1608 | WP_001701096.1 | ABC transporter substrate-binding protein | - |
| QQA26_RS14435 (2887178) | 2887178..2887573 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| QQA26_RS14440 (2887575) | 2887575..2887871 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| QQA26_RS14445 (2888076) | 2888076..2888558 | - | 483 | WP_000183494.1 | GyrI-like domain-containing protein | - |
| QQA26_RS14450 (2888611) | 2888611..2889003 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| QQA26_RS14455 (2889155) | 2889155..2889814 | + | 660 | WP_001221491.1 | quorum sensing response regulator transcription factor QseB | - |
| QQA26_RS14460 (2889811) | 2889811..2891160 | + | 1350 | WP_000673406.1 | quorum sensing histidine kinase QseC | - |
| QQA26_RS14465 (2891270) | 2891270..2891851 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| QQA26_RS14470 (2891882) | 2891882..2892196 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T283124 WP_000415584.1 NZ_CP126934:c2887871-2887575 [Escherichia coli O78:H4]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT283124 WP_000650107.1 NZ_CP126934:c2887573-2887178 [Escherichia coli O78:H4]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|