Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2495442..2496169 | Replicon | chromosome |
| Accession | NZ_CP126934 | ||
| Organism | Escherichia coli O78:H4 strain APEC E19057 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | QQA26_RS12515 | Protein ID | WP_000547564.1 |
| Coordinates | 2495858..2496169 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QQA26_RS12510 | Protein ID | WP_000126294.1 |
| Coordinates | 2495442..2495861 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA26_RS12490 (2490492) | 2490492..2491019 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| QQA26_RS12495 (2491168) | 2491168..2492178 | - | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| QQA26_RS12500 (2492438) | 2492438..2493895 | + | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| QQA26_RS12505 (2493904) | 2493904..2495328 | + | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| QQA26_RS12510 (2495442) | 2495442..2495861 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QQA26_RS12515 (2495858) | 2495858..2496169 | - | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QQA26_RS12520 (2496343) | 2496343..2497104 | - | 762 | WP_001026446.1 | hypothetical protein | - |
| QQA26_RS12525 (2497129) | 2497129..2497599 | - | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| QQA26_RS12530 (2497592) | 2497592..2498002 | - | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| QQA26_RS12535 (2497999) | 2497999..2498766 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| QQA26_RS12540 (2498766) | 2498766..2499308 | - | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| QQA26_RS12545 (2499318) | 2499318..2501027 | - | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T283120 WP_000547564.1 NZ_CP126934:c2496169-2495858 [Escherichia coli O78:H4]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT283120 WP_000126294.1 NZ_CP126934:c2495861-2495442 [Escherichia coli O78:H4]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|