Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 951518..951889 | Replicon | chromosome |
Accession | NZ_CP126934 | ||
Organism | Escherichia coli O78:H4 strain APEC E19057 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | QQA26_RS04770 | Protein ID | WP_001317028.1 |
Coordinates | 951695..951889 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 951518..951696 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA26_RS04740 (947270) | 947270..947443 | + | 174 | WP_001296046.1 | protein YnaL | - |
QQA26_RS04745 (947473) | 947473..948846 | + | 1374 | WP_000123718.1 | ATP-dependent RNA helicase DbpA | - |
QQA26_RS04750 (948975) | 948975..949910 | - | 936 | WP_001153728.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
QQA26_RS04755 (949962) | 949962..951197 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
QQA26_RS04760 (951199) | 951199..951414 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (951518) | 951518..951696 | + | 179 | NuclAT_0 | - | Antitoxin |
- (951518) | 951518..951696 | + | 179 | NuclAT_0 | - | Antitoxin |
- (951518) | 951518..951696 | + | 179 | NuclAT_0 | - | Antitoxin |
- (951518) | 951518..951696 | + | 179 | NuclAT_0 | - | Antitoxin |
QQA26_RS04765 (951493) | 951493..951702 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
QQA26_RS04770 (951695) | 951695..951889 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
QQA26_RS04775 (951946) | 951946..952755 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
QQA26_RS04780 (952748) | 952748..955348 | - | 2601 | WP_130563186.1 | exodeoxyribonuclease VIII | - |
QQA26_RS04785 (955450) | 955450..955725 | - | 276 | WP_000632297.1 | protein RacC | - |
QQA26_RS04790 (955800) | 955800..955970 | - | 171 | WP_001352098.1 | YdaE family protein | - |
QQA26_RS04795 (955970) | 955970..956191 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 949962..979747 | 29785 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T283109 WP_001317028.1 NZ_CP126934:c951889-951695 [Escherichia coli O78:H4]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT283109 NZ_CP126934:951518-951696 [Escherichia coli O78:H4]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|