Detailed information of TA system TA283102

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 89237..89658
• Replicon: plasmid pEND_Eco 19025-1
• Accession: NZ_CP126932
• Organism: Escherichia coli O78:H51 strain APEC E19025

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQA25_RS25280
• Protein ID: WP_231822392.1
• Coordinates: 89533..89658 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	89237..89435 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQA25_RS25245 (84256)	84256..84819	+	564	WP_001332335.1	class I SAM-dependent methyltransferase	-
QQA25_RS25250 (84905)	84905..85324	-	420	Protein_82	hypothetical protein	-
QQA25_RS25255 (85625)	85625..86122	+	498	Protein_83	single-stranded DNA-binding protein	-
QQA25_RS25260 (86220)	86220..86453	+	234	WP_000005988.1	DUF905 family protein	-
QQA25_RS25265 (86517)	86517..88466	+	1950	WP_039023646.1	ParB/RepB/Spo0J family partition protein	-
QQA25_RS25270 (88506)	88506..89268	+	763	Protein_86	plasmid SOS inhibition protein A	-
- (89237)	89237..89435	+	199	NuclAT_0	-	Antitoxin
- (89237)	89237..89435	+	199	NuclAT_0	-	Antitoxin
- (89237)	89237..89435	+	199	NuclAT_0	-	Antitoxin
- (89237)	89237..89435	+	199	NuclAT_0	-	Antitoxin
QQA25_RS25275 (89442)	89442..89591	+	150	Protein_87	DUF5431 family protein	-
QQA25_RS25280 (89533)	89533..89658	+	126	WP_231822392.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQA25_RS25285 (89959)	89959..90241	-	283	Protein_89	hypothetical protein	-
QQA25_RS25290 (90311)	90311..90517	+	207	WP_052908621.1	hypothetical protein	-
QQA25_RS25295 (90542)	90542..90829	+	288	WP_000107542.1	hypothetical protein	-
QQA25_RS25300 (90948)	90948..91769	+	822	WP_039023648.1	DUF932 domain-containing protein	-
QQA25_RS25305 (92065)	92065..92667	-	603	WP_000243701.1	transglycosylase SLT domain-containing protein	-
QQA25_RS25310 (93007)	93007..93390	+	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QQA25_RS25315 (93581)	93581..94228	+	648	WP_015387377.1	conjugal transfer transcriptional regulator TraJ	-
QQA25_RS25320 (94364)	94364..94579	+	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat	1..160439	160439

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4836.75 Da
• Isoelectric Point: 7.7833

>T283102 WP_231822392.1 NZ_CP126932:89533-89658 [Escherichia coli O78:H51]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYWEVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT283102 NZ_CP126932:89237-89435 [Escherichia coli O78:H51]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin