Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4927399..4928001 | Replicon | chromosome |
| Accession | NZ_CP126931 | ||
| Organism | Escherichia coli O78:H51 strain APEC E19025 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QQA25_RS24075 | Protein ID | WP_000897305.1 |
| Coordinates | 4927690..4928001 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QQA25_RS24070 | Protein ID | WP_000356397.1 |
| Coordinates | 4927399..4927689 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA25_RS24045 (4923324) | 4923324..4924226 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QQA25_RS24050 (4924223) | 4924223..4924858 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QQA25_RS24055 (4924855) | 4924855..4925784 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QQA25_RS24060 (4926114) | 4926114..4926356 | - | 243 | WP_001087409.1 | protein YiiF | - |
| QQA25_RS24065 (4926576) | 4926576..4926794 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| QQA25_RS24070 (4927399) | 4927399..4927689 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QQA25_RS24075 (4927690) | 4927690..4928001 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QQA25_RS24080 (4928230) | 4928230..4929138 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| QQA25_RS24085 (4929202) | 4929202..4930143 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QQA25_RS24090 (4930188) | 4930188..4930625 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QQA25_RS24095 (4930622) | 4930622..4931494 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QQA25_RS24100 (4931488) | 4931488..4932087 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| QQA25_RS24105 (4932186) | 4932186..4932971 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T283100 WP_000897305.1 NZ_CP126931:c4928001-4927690 [Escherichia coli O78:H51]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|