Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 3935386..3935927 | Replicon | chromosome |
Accession | NZ_CP126931 | ||
Organism | Escherichia coli O78:H51 strain APEC E19025 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | U9XPG0 |
Locus tag | QQA25_RS19220 | Protein ID | WP_000615976.1 |
Coordinates | 3935649..3935927 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | S1EWQ0 |
Locus tag | QQA25_RS19215 | Protein ID | WP_000729704.1 |
Coordinates | 3935386..3935646 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA25_RS19190 (3931169) | 3931169..3931954 | - | 786 | WP_000207575.1 | putative lateral flagellar export/assembly protein LafU | - |
QQA25_RS19195 (3931926) | 3931926..3933638 | + | 1713 | Protein_3759 | flagellar biosynthesis protein FlhA | - |
QQA25_RS19200 (3933743) | 3933743..3934021 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
QQA25_RS19205 (3934014) | 3934014..3934370 | + | 357 | WP_001030483.1 | type II toxin-antitoxin system HicB family antitoxin | - |
QQA25_RS19210 (3934427) | 3934427..3935200 | - | 774 | WP_148935748.1 | C40 family peptidase | - |
QQA25_RS19215 (3935386) | 3935386..3935646 | + | 261 | WP_000729704.1 | type II toxin-antitoxin system antitoxin DinJ | Antitoxin |
QQA25_RS19220 (3935649) | 3935649..3935927 | + | 279 | WP_000615976.1 | type II toxin-antitoxin system mRNA interferase toxin YafQ | Toxin |
QQA25_RS19225 (3936083) | 3936083..3936823 | + | 741 | WP_001225679.1 | peptidoglycan meso-diaminopimelic acid protein amidase | - |
QQA25_RS19230 (3936794) | 3936794..3937561 | - | 768 | WP_000333380.1 | class II glutamine amidotransferase | - |
QQA25_RS19235 (3937767) | 3937767..3938345 | - | 579 | WP_000284050.1 | D-sedoheptulose 7-phosphate isomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10800.59 Da Isoelectric Point: 10.0702
>T283096 WP_000615976.1 NZ_CP126931:3935649-3935927 [Escherichia coli O78:H51]
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XPG0 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 4ML0 | |
AlphaFold DB | A0A0E0Y6Z6 |