Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1978928..1979759 Replicon chromosome
Accession NZ_CP126931
Organism Escherichia coli O78:H51 strain APEC E19025

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QQA25_RS09550 Protein ID WP_000854814.1
Coordinates 1978928..1979302 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEU4
Locus tag QQA25_RS09555 Protein ID WP_001285591.1
Coordinates 1979391..1979759 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA25_RS09510 (1974963) 1974963..1975481 - 519 WP_000115885.1 ClbS/DfsB family four-helix bundle protein -
QQA25_RS09515 (1975609) 1975609..1976082 + 474 WP_024222062.1 DNA gyrase inhibitor SbmC -
QQA25_RS09520 (1976280) 1976280..1977338 + 1059 WP_001200891.1 FUSC family protein -
QQA25_RS09525 (1977510) 1977510..1977839 + 330 WP_000450409.1 DUF496 family protein -
QQA25_RS09530 (1977940) 1977940..1978074 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QQA25_RS09535 (1978194) 1978194..1978322 + 129 Protein_1866 transposase domain-containing protein -
QQA25_RS09540 (1978611) 1978611..1978691 - 81 Protein_1867 hypothetical protein -
QQA25_RS09545 (1978737) 1978737..1978931 - 195 WP_039023483.1 DUF5983 family protein -
QQA25_RS09550 (1978928) 1978928..1979302 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQA25_RS09555 (1979391) 1979391..1979759 - 369 WP_001285591.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA25_RS09560 (1979833) 1979833..1980054 - 222 WP_000692323.1 DUF987 domain-containing protein -
QQA25_RS09565 (1980117) 1980117..1980593 - 477 WP_001186726.1 RadC family protein -
QQA25_RS09570 (1980609) 1980609..1981088 - 480 WP_000860087.1 antirestriction protein -
QQA25_RS09575 (1981170) 1981170..1981988 - 819 WP_001234629.1 DUF932 domain-containing protein -
QQA25_RS09580 (1982088) 1982088..1982321 - 234 WP_001119729.1 DUF905 family protein -
QQA25_RS09585 (1982379) 1982379..1983056 + 678 WP_001339397.1 IS66-like element accessory protein TnpA -
QQA25_RS09590 (1983056) 1983056..1983403 + 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 1973724..1974944 1220


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T283087 WP_000854814.1 NZ_CP126931:c1979302-1978928 [Escherichia coli O78:H51]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13650.54 Da        Isoelectric Point: 6.6249

>AT283087 WP_001285591.1 NZ_CP126931:c1979759-1979391 [Escherichia coli O78:H51]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEU4

References