Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 640590..641389 | Replicon | chromosome |
Accession | NZ_CP126931 | ||
Organism | Escherichia coli O78:H51 strain APEC E19025 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | QQA25_RS03115 | Protein ID | WP_000347266.1 |
Coordinates | 640590..641054 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QQA25_RS03120 | Protein ID | WP_001307405.1 |
Coordinates | 641054..641389 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA25_RS03085 (635591) | 635591..636025 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QQA25_RS03090 (636043) | 636043..636921 | - | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QQA25_RS03095 (636911) | 636911..637690 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QQA25_RS03100 (637701) | 637701..638174 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QQA25_RS03105 (638197) | 638197..639477 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QQA25_RS03110 (639726) | 639726..640535 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QQA25_RS03115 (640590) | 640590..641054 | - | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QQA25_RS03120 (641054) | 641054..641389 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QQA25_RS03125 (641538) | 641538..643109 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
QQA25_RS03130 (643484) | 643484..644818 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QQA25_RS03135 (644834) | 644834..645604 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T283081 WP_000347266.1 NZ_CP126931:c641054-640590 [Escherichia coli O78:H51]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |