Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 167594..167848 | Replicon | plasmid pEND_Eco 12053-1 |
| Accession | NZ_CP126929 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E12053 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QQA27_RS24820 | Protein ID | WP_001312851.1 |
| Coordinates | 167594..167743 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 167787..167848 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA27_RS24775 (163137) | 163137..163484 | + | 348 | Protein_172 | IS1-like element IS1A family transposase | - |
| QQA27_RS24780 (163500) | 163500..163820 | - | 321 | Protein_173 | serine acetyltransferase | - |
| QQA27_RS24785 (163924) | 163924..164211 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QQA27_RS24790 (164208) | 164208..164459 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QQA27_RS24795 (165422) | 165422..166279 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| QQA27_RS24800 (166272) | 166272..166754 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| QQA27_RS24805 (166747) | 166747..166794 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| QQA27_RS24810 (166785) | 166785..167036 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| QQA27_RS24815 (167053) | 167053..167310 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QQA27_RS24820 (167594) | 167594..167743 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (167787) | 167787..167848 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (167787) | 167787..167848 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (167787) | 167787..167848 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (167787) | 167787..167848 | + | 62 | NuclAT_1 | - | Antitoxin |
| QQA27_RS24825 (168104) | 168104..168178 | - | 75 | Protein_182 | endonuclease | - |
| QQA27_RS24830 (168424) | 168424..168636 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| QQA27_RS24835 (168772) | 168772..169332 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| QQA27_RS24840 (169435) | 169435..170295 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| QQA27_RS24845 (170354) | 170354..171100 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..189727 | 189727 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T283076 WP_001312851.1 NZ_CP126929:c167743-167594 [Escherichia coli O2:K1:H4]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT283076 NZ_CP126929:167787-167848 [Escherichia coli O2:K1:H4]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
