Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4690676..4691278 | Replicon | chromosome |
| Accession | NZ_CP126928 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E12053 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QQA27_RS22895 | Protein ID | WP_000897302.1 |
| Coordinates | 4690967..4691278 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QQA27_RS22890 | Protein ID | WP_000356397.1 |
| Coordinates | 4690676..4690966 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA27_RS22865 (4686749) | 4686749..4687651 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QQA27_RS22870 (4687648) | 4687648..4688283 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QQA27_RS22875 (4688280) | 4688280..4689209 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| QQA27_RS22880 (4689425) | 4689425..4689643 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| QQA27_RS22885 (4690039) | 4690039..4690317 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| QQA27_RS22890 (4690676) | 4690676..4690966 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QQA27_RS22895 (4690967) | 4690967..4691278 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QQA27_RS22900 (4691507) | 4691507..4692415 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| QQA27_RS22905 (4692479) | 4692479..4693420 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QQA27_RS22910 (4693465) | 4693465..4693902 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QQA27_RS22915 (4693899) | 4693899..4694771 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QQA27_RS22920 (4694765) | 4694765..4695364 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T283068 WP_000897302.1 NZ_CP126928:c4691278-4690967 [Escherichia coli O2:K1:H4]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|