Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3701295..3701989 | Replicon | chromosome |
Accession | NZ_CP126928 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E12053 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | QQA27_RS18230 | Protein ID | WP_001263500.1 |
Coordinates | 3701591..3701989 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QQA27_RS18225 | Protein ID | WP_000554758.1 |
Coordinates | 3701295..3701588 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA27_RS18200 (3696858) | 3696858..3697328 | + | 471 | Protein_3564 | transposase | - |
QQA27_RS18205 (3697411) | 3697411..3697569 | - | 159 | WP_014639450.1 | hypothetical protein | - |
QQA27_RS18210 (3697648) | 3697648..3699360 | - | 1713 | Protein_3566 | flagellar biosynthesis protein FlhA | - |
QQA27_RS18215 (3699332) | 3699332..3700117 | + | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
QQA27_RS18220 (3700188) | 3700188..3701243 | + | 1056 | WP_001226168.1 | DNA polymerase IV | - |
QQA27_RS18225 (3701295) | 3701295..3701588 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QQA27_RS18230 (3701591) | 3701591..3701989 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QQA27_RS18235 (3701999) | 3701999..3702451 | + | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
QQA27_RS18240 (3702641) | 3702641..3703780 | + | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
QQA27_RS18245 (3703777) | 3703777..3704391 | + | 615 | WP_000602123.1 | peptide chain release factor H | - |
QQA27_RS18250 (3704448) | 3704448..3705905 | - | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
QQA27_RS18255 (3706166) | 3706166..3706624 | + | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T283060 WP_001263500.1 NZ_CP126928:3701591-3701989 [Escherichia coli O2:K1:H4]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|