Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3529505..3530184 | Replicon | chromosome |
Accession | NZ_CP126928 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E12053 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0VBP6 |
Locus tag | QQA27_RS17405 | Protein ID | WP_000057524.1 |
Coordinates | 3529882..3530184 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QQA27_RS17400 | Protein ID | WP_000806442.1 |
Coordinates | 3529505..3529846 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA27_RS17390 (3525749) | 3525749..3526681 | - | 933 | WP_000883052.1 | glutaminase A | - |
QQA27_RS17395 (3526943) | 3526943..3529447 | + | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
QQA27_RS17400 (3529505) | 3529505..3529846 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QQA27_RS17405 (3529882) | 3529882..3530184 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQA27_RS17410 (3530317) | 3530317..3531111 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
QQA27_RS17415 (3531315) | 3531315..3531794 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QQA27_RS17420 (3531818) | 3531818..3532396 | + | 579 | WP_021522671.1 | hypothetical protein | - |
QQA27_RS17425 (3532615) | 3532615..3533118 | + | 504 | WP_000667000.1 | hypothetical protein | - |
QQA27_RS17430 (3533156) | 3533156..3534808 | - | 1653 | WP_001513633.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3522194..3533118 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T283058 WP_000057524.1 NZ_CP126928:c3530184-3529882 [Escherichia coli O2:K1:H4]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT283058 WP_000806442.1 NZ_CP126928:c3529846-3529505 [Escherichia coli O2:K1:H4]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|