Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2396532..2397094 | Replicon | chromosome |
| Accession | NZ_CP126928 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E12053 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1Q1V8 |
| Locus tag | QQA27_RS11665 | Protein ID | WP_000605675.1 |
| Coordinates | 2396816..2397094 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1PAQ1 |
| Locus tag | QQA27_RS11660 | Protein ID | WP_000781370.1 |
| Coordinates | 2396532..2396816 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA27_RS11645 (2391713) | 2391713..2394760 | + | 3048 | WP_011478186.1 | formate dehydrogenase-N subunit alpha | - |
| QQA27_RS11650 (2394773) | 2394773..2395657 | + | 885 | WP_001240584.1 | formate dehydrogenase N subunit beta | - |
| QQA27_RS11655 (2395650) | 2395650..2396303 | + | 654 | WP_000045647.1 | formate dehydrogenase-N subunit gamma | - |
| QQA27_RS11660 (2396532) | 2396532..2396816 | - | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
| QQA27_RS11665 (2396816) | 2396816..2397094 | - | 279 | WP_000605675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQA27_RS11670 (2397280) | 2397280..2398290 | - | 1011 | WP_000642412.1 | alcohol dehydrogenase AdhP | - |
| QQA27_RS11675 (2398424) | 2398424..2400121 | - | 1698 | WP_289245902.1 | malate dehydrogenase | - |
| QQA27_RS11680 (2400277) | 2400277..2400414 | - | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
| QQA27_RS11685 (2400516) | 2400516..2400731 | - | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
| QQA27_RS11690 (2401076) | 2401076..2401507 | + | 432 | WP_000152310.1 | peroxiredoxin OsmC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10537.16 Da Isoelectric Point: 7.3206
>T283052 WP_000605675.1 NZ_CP126928:c2397094-2396816 [Escherichia coli O2:K1:H4]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1Q1V8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2ICT | |
| PDB | 2ICP | |
| AlphaFold DB | A0A829CUG6 |