Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 189666..189888 | Replicon | chromosome |
| Accession | NZ_CP126928 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E12053 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | QQA27_RS00900 | Protein ID | WP_001295224.1 |
| Coordinates | 189781..189888 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 189666..189724 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA27_RS00875 | 185055..186038 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| QQA27_RS00880 | 186035..187039 | + | 1005 | WP_000103579.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| QQA27_RS00885 | 187069..188340 | - | 1272 | WP_001332306.1 | aromatic amino acid transport family protein | - |
| QQA27_RS00890 | 188816..188923 | + | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| QQA27_RS00895 | 189298..189405 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 189666..189724 | - | 59 | - | - | Antitoxin |
| QQA27_RS00900 | 189781..189888 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| QQA27_RS00905 | 189974..191653 | - | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| QQA27_RS00910 | 191650..191841 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| QQA27_RS00915 | 191838..193409 | - | 1572 | WP_001204957.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| QQA27_RS00920 | 193682..193870 | + | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
| QQA27_RS00925 | 193882..194634 | + | 753 | WP_000279545.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T283045 WP_001295224.1 NZ_CP126928:189781-189888 [Escherichia coli O2:K1:H4]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 59 bp
>AT283045 NZ_CP126928:c189724-189666 [Escherichia coli O2:K1:H4]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|