Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 141681..141935 | Replicon | plasmid pEND_Eco 19035-1 |
| Accession | NZ_CP126927 | ||
| Organism | Escherichia coli O2:K1:H5 strain APEC E19035 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QQA32_RS26835 | Protein ID | WP_001312851.1 |
| Coordinates | 141681..141830 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 141874..141935 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA32_RS26790 (137224) | 137224..137571 | + | 348 | Protein_134 | IS1-like element IS1A family transposase | - |
| QQA32_RS26795 (137587) | 137587..137907 | - | 321 | Protein_135 | serine acetyltransferase | - |
| QQA32_RS26800 (138011) | 138011..138298 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QQA32_RS26805 (138295) | 138295..138546 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QQA32_RS26810 (139509) | 139509..140366 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| QQA32_RS26815 (140359) | 140359..140841 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| QQA32_RS26820 (140834) | 140834..140881 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| QQA32_RS26825 (140872) | 140872..141123 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| QQA32_RS26830 (141140) | 141140..141397 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QQA32_RS26835 (141681) | 141681..141830 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (141874) | 141874..141935 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (141874) | 141874..141935 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (141874) | 141874..141935 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (141874) | 141874..141935 | + | 62 | NuclAT_1 | - | Antitoxin |
| QQA32_RS26840 (142191) | 142191..142265 | - | 75 | Protein_144 | endonuclease | - |
| QQA32_RS26845 (142560) | 142560..144131 | - | 1572 | WP_000381395.1 | IS66-like element ISCro1 family transposase | - |
| QQA32_RS26850 (144151) | 144151..144498 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QQA32_RS26855 (144498) | 144498..145175 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QQA32_RS26860 (145212) | 145212..145430 | - | 219 | WP_021512285.1 | ANR family transcriptional regulator | - |
| QQA32_RS26865 (145566) | 145566..146126 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..193604 | 193604 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T283038 WP_001312851.1 NZ_CP126927:c141830-141681 [Escherichia coli O2:K1:H5]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT283038 NZ_CP126927:141874-141935 [Escherichia coli O2:K1:H5]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
