Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5094638..5095240 | Replicon | chromosome |
| Accession | NZ_CP126926 | ||
| Organism | Escherichia coli O2:K1:H5 strain APEC E19035 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QQA32_RS25080 | Protein ID | WP_000897302.1 |
| Coordinates | 5094929..5095240 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QQA32_RS25075 | Protein ID | WP_000356397.1 |
| Coordinates | 5094638..5094928 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA32_RS25050 (5090711) | 5090711..5091613 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QQA32_RS25055 (5091610) | 5091610..5092245 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QQA32_RS25060 (5092242) | 5092242..5093171 | + | 930 | WP_103433215.1 | formate dehydrogenase accessory protein FdhE | - |
| QQA32_RS25065 (5093387) | 5093387..5093605 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| QQA32_RS25070 (5094001) | 5094001..5094279 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| QQA32_RS25075 (5094638) | 5094638..5094928 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QQA32_RS25080 (5094929) | 5094929..5095240 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QQA32_RS25085 (5095469) | 5095469..5096377 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| QQA32_RS25090 (5096441) | 5096441..5097382 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QQA32_RS25095 (5097427) | 5097427..5097864 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QQA32_RS25100 (5097861) | 5097861..5098733 | - | 873 | WP_289245793.1 | virulence factor BrkB family protein | - |
| QQA32_RS25105 (5098727) | 5098727..5099326 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T283033 WP_000897302.1 NZ_CP126926:c5095240-5094929 [Escherichia coli O2:K1:H5]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|