Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3984307..3985001 | Replicon | chromosome |
Accession | NZ_CP126926 | ||
Organism | Escherichia coli O2:K1:H5 strain APEC E19035 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | QQA32_RS19600 | Protein ID | WP_001263500.1 |
Coordinates | 3984307..3984705 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QQA32_RS19605 | Protein ID | WP_000554758.1 |
Coordinates | 3984708..3985001 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA32_RS19575 (3979672) | 3979672..3980130 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
QQA32_RS19580 (3980391) | 3980391..3981848 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
QQA32_RS19585 (3981905) | 3981905..3982519 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
QQA32_RS19590 (3982516) | 3982516..3983655 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
QQA32_RS19595 (3983845) | 3983845..3984297 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
QQA32_RS19600 (3984307) | 3984307..3984705 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QQA32_RS19605 (3984708) | 3984708..3985001 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QQA32_RS19610 (3985053) | 3985053..3986108 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
QQA32_RS19615 (3986179) | 3986179..3986964 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
QQA32_RS19620 (3986936) | 3986936..3988648 | + | 1713 | Protein_3847 | flagellar biosynthesis protein FlhA | - |
QQA32_RS19625 (3988727) | 3988727..3988885 | + | 159 | WP_014639450.1 | hypothetical protein | - |
QQA32_RS19630 (3988968) | 3988968..3989465 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3984307..4004661 | 20354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T283029 WP_001263500.1 NZ_CP126926:c3984705-3984307 [Escherichia coli O2:K1:H5]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|