Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3755390..3756069 | Replicon | chromosome |
Accession | NZ_CP126926 | ||
Organism | Escherichia coli O2:K1:H5 strain APEC E19035 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0VBP6 |
Locus tag | QQA32_RS18540 | Protein ID | WP_000057524.1 |
Coordinates | 3755767..3756069 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QQA32_RS18535 | Protein ID | WP_000806442.1 |
Coordinates | 3755390..3755731 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA32_RS18525 (3751634) | 3751634..3752566 | - | 933 | WP_000883052.1 | glutaminase A | - |
QQA32_RS18530 (3752828) | 3752828..3755332 | + | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
QQA32_RS18535 (3755390) | 3755390..3755731 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QQA32_RS18540 (3755767) | 3755767..3756069 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQA32_RS18545 (3756202) | 3756202..3756996 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
QQA32_RS18550 (3757200) | 3757200..3757679 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QQA32_RS18555 (3757703) | 3757703..3758503 | + | 801 | WP_000439798.1 | hypothetical protein | - |
QQA32_RS18560 (3758500) | 3758500..3759003 | + | 504 | WP_000667000.1 | hypothetical protein | - |
QQA32_RS18565 (3759041) | 3759041..3760692 | - | 1652 | Protein_3638 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3748079..3759003 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T283027 WP_000057524.1 NZ_CP126926:c3756069-3755767 [Escherichia coli O2:K1:H5]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT283027 WP_000806442.1 NZ_CP126926:c3755731-3755390 [Escherichia coli O2:K1:H5]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|