Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2750590..2751152 | Replicon | chromosome |
Accession | NZ_CP126926 | ||
Organism | Escherichia coli O2:K1:H5 strain APEC E19035 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1Q1V8 |
Locus tag | QQA32_RS13460 | Protein ID | WP_000605675.1 |
Coordinates | 2750590..2750868 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1PAQ1 |
Locus tag | QQA32_RS13465 | Protein ID | WP_000781370.1 |
Coordinates | 2750868..2751152 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA32_RS13435 (2746177) | 2746177..2746608 | - | 432 | WP_000152310.1 | peroxiredoxin OsmC | - |
QQA32_RS13440 (2746953) | 2746953..2747168 | + | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
QQA32_RS13445 (2747270) | 2747270..2747407 | + | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
QQA32_RS13450 (2747563) | 2747563..2749260 | + | 1698 | WP_000433462.1 | malate dehydrogenase | - |
QQA32_RS13455 (2749394) | 2749394..2750404 | + | 1011 | WP_000642412.1 | alcohol dehydrogenase AdhP | - |
QQA32_RS13460 (2750590) | 2750590..2750868 | + | 279 | WP_000605675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQA32_RS13465 (2750868) | 2750868..2751152 | + | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
QQA32_RS13470 (2751381) | 2751381..2752034 | - | 654 | WP_000045647.1 | formate dehydrogenase-N subunit gamma | - |
QQA32_RS13475 (2752027) | 2752027..2752911 | - | 885 | WP_001240584.1 | formate dehydrogenase N subunit beta | - |
QQA32_RS13480 (2752924) | 2752924..2755971 | - | 3048 | WP_011478186.1 | formate dehydrogenase-N subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10537.16 Da Isoelectric Point: 7.3206
>T283026 WP_000605675.1 NZ_CP126926:2750590-2750868 [Escherichia coli O2:K1:H5]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1Q1V8 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2ICT | |
PDB | 2ICP | |
AlphaFold DB | A0A829CUG6 |