Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3716278..3716923 | Replicon | chromosome |
Accession | NZ_CP126681 | ||
Organism | Pantoea agglomerans strain FL1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QPJ96_RS17565 | Protein ID | WP_285086677.1 |
Coordinates | 3716570..3716923 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QPJ96_RS17560 | Protein ID | WP_161733580.1 |
Coordinates | 3716278..3716577 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPJ96_RS17545 (QPJ96_17545) | 3712192..3713976 | - | 1785 | WP_253420768.1 | GMC family oxidoreductase | - |
QPJ96_RS17550 (QPJ96_17550) | 3713979..3714713 | - | 735 | WP_161733584.1 | gluconate 2-dehydrogenase subunit 3 family protein | - |
QPJ96_RS17555 (QPJ96_17555) | 3714989..3716230 | + | 1242 | WP_161733582.1 | peptide antibiotic transporter SbmA | - |
QPJ96_RS17560 (QPJ96_17560) | 3716278..3716577 | - | 300 | WP_161733580.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QPJ96_RS17565 (QPJ96_17565) | 3716570..3716923 | - | 354 | WP_285086677.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QPJ96_RS17570 (QPJ96_17570) | 3717133..3718185 | - | 1053 | WP_161733578.1 | YncE family protein | - |
QPJ96_RS17575 (QPJ96_17575) | 3718383..3718592 | - | 210 | WP_009092571.1 | DUF1471 domain-containing protein | - |
QPJ96_RS17580 (QPJ96_17580) | 3718805..3719992 | - | 1188 | WP_285086679.1 | MFS transporter | - |
QPJ96_RS17585 (QPJ96_17585) | 3720097..3721062 | + | 966 | WP_161733574.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13379.27 Da Isoelectric Point: 6.4741
>T283007 WP_285086677.1 NZ_CP126681:c3716923-3716570 [Pantoea agglomerans]
MWDVDTTKRFDEWFKAQSEELKEDMLAAIVILSEYGPHLAKPFADTVDGSDFPNMKELRVQHQGKPIRAFFAFDPSRRGI
VLCAGDKTGVKEKKFYKDMIKLADAEFRKYLNGGDNG
MWDVDTTKRFDEWFKAQSEELKEDMLAAIVILSEYGPHLAKPFADTVDGSDFPNMKELRVQHQGKPIRAFFAFDPSRRGI
VLCAGDKTGVKEKKFYKDMIKLADAEFRKYLNGGDNG
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|