Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1597519..1598179 | Replicon | chromosome |
| Accession | NZ_CP126681 | ||
| Organism | Pantoea agglomerans strain FL1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QPJ96_RS07495 | Protein ID | WP_253419151.1 |
| Coordinates | 1597519..1597872 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QPJ96_RS07500 | Protein ID | WP_033733169.1 |
| Coordinates | 1597877..1598179 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPJ96_RS07480 (QPJ96_07480) | 1593122..1593403 | + | 282 | WP_285088349.1 | hypothetical protein | - |
| QPJ96_RS07485 (QPJ96_07485) | 1593557..1595719 | - | 2163 | WP_285088350.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
| QPJ96_RS07490 (QPJ96_07490) | 1596145..1597233 | + | 1089 | WP_161736888.1 | YncE family protein | - |
| QPJ96_RS07495 (QPJ96_07495) | 1597519..1597872 | + | 354 | WP_253419151.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QPJ96_RS07500 (QPJ96_07500) | 1597877..1598179 | + | 303 | WP_033733169.1 | XRE family transcriptional regulator | Antitoxin |
| QPJ96_RS07510 (QPJ96_07510) | 1598849..1599772 | + | 924 | WP_285088351.1 | sugar ABC transporter substrate-binding protein | - |
| QPJ96_RS07515 (QPJ96_07515) | 1599805..1601289 | + | 1485 | WP_098052921.1 | sugar ABC transporter ATP-binding protein | - |
| QPJ96_RS07520 (QPJ96_07520) | 1601313..1602338 | + | 1026 | WP_190285965.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13628.75 Da Isoelectric Point: 10.1378
>T283004 WP_253419151.1 NZ_CP126681:1597519-1597872 [Pantoea agglomerans]
VWMIKTTERFDRWFTLLNDSDRACVLAALMVLREKGPGLSRPYADTIKGSAYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKAGNEKRFYREMLPVADREFTHWLKSFNHKE
VWMIKTTERFDRWFTLLNDSDRACVLAALMVLREKGPGLSRPYADTIKGSAYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKAGNEKRFYREMLPVADREFTHWLKSFNHKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|