Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1569789..1569969 | Replicon | chromosome |
| Accession | NZ_CP126631 | ||
| Organism | Staphylococcus aureus strain 33-40 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | QPR37_RS07925 | Protein ID | WP_001801861.1 |
| Coordinates | 1569874..1569969 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1569789..1569846 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPR37_RS07905 (QPR37_07905) | 1568137..1568514 | + | 378 | WP_063651591.1 | DUF1433 domain-containing protein | - |
| QPR37_RS07910 (QPR37_07910) | 1568640..1569143 | - | 504 | Protein_1507 | polysaccharide lyase beta-sandwich domain-containing protein | - |
| QPR37_RS07915 (QPR37_07915) | 1569502..1569657 | - | 156 | WP_174834634.1 | hypothetical protein | - |
| QPR37_RS07920 (QPR37_07920) | 1569653..1569751 | - | 99 | Protein_1509 | hypothetical protein | - |
| - | 1569789..1569846 | + | 58 | - | - | Antitoxin |
| QPR37_RS07925 (QPR37_07925) | 1569874..1569969 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| QPR37_RS07930 (QPR37_07930) | 1570128..1570755 | + | 628 | Protein_1511 | ImmA/IrrE family metallo-endopeptidase | - |
| QPR37_RS07935 (QPR37_07935) | 1570953..1571525 | - | 573 | WP_063651584.1 | hypothetical protein | - |
| QPR37_RS07940 (QPR37_07940) | 1571626..1571967 | - | 342 | WP_141060399.1 | DUF3969 family protein | - |
| QPR37_RS07945 (QPR37_07945) | 1572008..1572634 | - | 627 | WP_063651579.1 | hypothetical protein | - |
| QPR37_RS07950 (QPR37_07950) | 1572710..1573705 | - | 996 | WP_141060398.1 | DUF4352 domain-containing protein | - |
| QPR37_RS07955 (QPR37_07955) | 1573787..1574437 | - | 651 | WP_078316641.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD / hysA | 1542079..1575195 | 33116 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T283001 WP_001801861.1 NZ_CP126631:c1569969-1569874 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT283001 NZ_CP126631:1569789-1569846 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|