Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1569789..1569969 Replicon chromosome
Accession NZ_CP126631
Organism Staphylococcus aureus strain 33-40

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag QPR37_RS07925 Protein ID WP_001801861.1
Coordinates 1569874..1569969 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1569789..1569846 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPR37_RS07905 (QPR37_07905) 1568137..1568514 + 378 WP_063651591.1 DUF1433 domain-containing protein -
QPR37_RS07910 (QPR37_07910) 1568640..1569143 - 504 Protein_1507 polysaccharide lyase beta-sandwich domain-containing protein -
QPR37_RS07915 (QPR37_07915) 1569502..1569657 - 156 WP_174834634.1 hypothetical protein -
QPR37_RS07920 (QPR37_07920) 1569653..1569751 - 99 Protein_1509 hypothetical protein -
- 1569789..1569846 + 58 - - Antitoxin
QPR37_RS07925 (QPR37_07925) 1569874..1569969 - 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
QPR37_RS07930 (QPR37_07930) 1570128..1570755 + 628 Protein_1511 ImmA/IrrE family metallo-endopeptidase -
QPR37_RS07935 (QPR37_07935) 1570953..1571525 - 573 WP_063651584.1 hypothetical protein -
QPR37_RS07940 (QPR37_07940) 1571626..1571967 - 342 WP_141060399.1 DUF3969 family protein -
QPR37_RS07945 (QPR37_07945) 1572008..1572634 - 627 WP_063651579.1 hypothetical protein -
QPR37_RS07950 (QPR37_07950) 1572710..1573705 - 996 WP_141060398.1 DUF4352 domain-containing protein -
QPR37_RS07955 (QPR37_07955) 1573787..1574437 - 651 WP_078316641.1 excalibur calcium-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - hlgA / lukD / hysA 1542079..1575195 33116


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T283001 WP_001801861.1 NZ_CP126631:c1569969-1569874 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT283001 NZ_CP126631:1569789-1569846 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References