Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1456921..1457498 Replicon chromosome
Accession NZ_CP126631
Organism Staphylococcus aureus strain 33-40

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QPR37_RS07160 Protein ID WP_063651046.1
Coordinates 1456921..1457175 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QPR37_RS07170 Protein ID WP_000028426.1
Coordinates 1457325..1457498 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPR37_RS07095 (QPR37_07095) 1451975..1452736 + 762 WP_063651054.1 AP2 domain-containing protein -
QPR37_RS07100 (QPR37_07100) 1452729..1453490 + 762 WP_113583937.1 conserved phage C-terminal domain-containing protein -
QPR37_RS07105 (QPR37_07105) 1453503..1454288 + 786 WP_285146562.1 ATP-binding protein -
QPR37_RS07110 (QPR37_07110) 1454285..1454444 + 160 Protein_1384 hypothetical protein -
QPR37_RS07115 (QPR37_07115) 1454457..1454678 + 222 WP_001123684.1 DUF3269 family protein -
QPR37_RS07120 (QPR37_07120) 1454689..1455093 + 405 WP_259378785.1 DUF1064 domain-containing protein -
QPR37_RS07125 (QPR37_07125) 1455098..1455283 + 186 WP_063651049.1 DUF3113 family protein -
QPR37_RS07130 (QPR37_07130) 1455284..1455552 + 269 Protein_1388 helix-turn-helix transcriptional regulator -
QPR37_RS07135 (QPR37_07135) 1455553..1455912 + 360 WP_063651048.1 SA1788 family PVL leukocidin-associated protein -
QPR37_RS07140 (QPR37_07140) 1455912..1456169 + 258 WP_000111490.1 DUF3310 domain-containing protein -
QPR37_RS07145 (QPR37_07145) 1456172..1456372 + 201 WP_015984498.1 hypothetical protein -
QPR37_RS07150 (QPR37_07150) 1456381..1456629 + 249 WP_072437343.1 SAV1978 family virulence-associated passenger protein -
QPR37_RS07155 (QPR37_07155) 1456644..1456928 + 285 WP_078316597.1 hypothetical protein -
QPR37_RS07160 (QPR37_07160) 1456921..1457175 + 255 WP_063651046.1 DUF1024 family protein Toxin
QPR37_RS07165 (QPR37_07165) 1457162..1457335 + 174 WP_063651045.1 hypothetical protein -
QPR37_RS07170 (QPR37_07170) 1457325..1457498 + 174 WP_000028426.1 hypothetical protein Antitoxin
QPR37_RS07175 (QPR37_07175) 1457499..1457780 + 282 WP_063651044.1 hypothetical protein -
QPR37_RS07180 (QPR37_07180) 1457781..1457942 + 162 WP_000889682.1 hypothetical protein -
QPR37_RS07185 (QPR37_07185) 1457957..1458493 + 537 WP_259378787.1 dUTPase -
QPR37_RS07190 (QPR37_07190) 1458530..1458730 + 201 WP_063651040.1 hypothetical protein -
QPR37_RS07195 (QPR37_07195) 1458730..1458924 + 195 WP_063651038.1 DUF1381 domain-containing protein -
QPR37_RS07200 (QPR37_07200) 1458937..1459104 + 168 WP_154445040.1 hypothetical protein -
QPR37_RS07205 (QPR37_07205) 1459125..1459511 + 387 WP_063651037.1 hypothetical protein -
QPR37_RS07210 (QPR37_07210) 1459508..1459657 + 150 WP_000595265.1 transcriptional activator RinB -
QPR37_RS07215 (QPR37_07215) 1459657..1459857 + 201 WP_000265041.1 DUF1514 family protein -
QPR37_RS07220 (QPR37_07220) 1459880..1460350 + 471 WP_076749280.1 hypothetical protein -
QPR37_RS07225 (QPR37_07225) 1460465..1460917 + 453 WP_063651034.1 nucleoside triphosphate pyrophosphohydrolase family protein -
QPR37_RS07230 (QPR37_07230) 1460933..1461277 + 345 WP_000817289.1 HNH endonuclease -
QPR37_RS07235 (QPR37_07235) 1461407..1461874 + 468 WP_000919026.1 phage terminase small subunit P27 family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukS-PV / lukD 1443147..1487723 44576


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9483.48 Da        Isoelectric Point: 3.8928

>T282997 WP_063651046.1 NZ_CP126631:1456921-1457175 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKARAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEKI

Download         Length: 255 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6496.35 Da        Isoelectric Point: 4.4262

>AT282997 WP_000028426.1 NZ_CP126631:1457325-1457498 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVRLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References