Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1226366..1226645 | Replicon | chromosome |
Accession | NZ_CP126631 | ||
Organism | Staphylococcus aureus strain 33-40 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | QPR37_RS05880 | Protein ID | WP_001802298.1 |
Coordinates | 1226366..1226470 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1226466..1226645 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPR37_RS05860 (QPR37_05860) | 1221781..1222564 | + | 784 | Protein_1139 | ABC transporter ATP-binding protein | - |
QPR37_RS05865 (QPR37_05865) | 1222632..1223489 | + | 858 | WP_063652378.1 | HAD family hydrolase | - |
QPR37_RS05870 (QPR37_05870) | 1224544..1225681 | + | 1138 | Protein_1141 | SAP domain-containing protein | - |
QPR37_RS05875 (QPR37_05875) | 1225724..1226244 | + | 521 | Protein_1142 | recombinase family protein | - |
QPR37_RS05880 (QPR37_05880) | 1226366..1226470 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 1226466..1226645 | - | 180 | - | - | Antitoxin |
QPR37_RS05890 (QPR37_05890) | 1226972..1228063 | - | 1092 | WP_109162112.1 | transcriptional regulator | - |
QPR37_RS05895 (QPR37_05895) | 1228329..1229309 | - | 981 | WP_000019739.1 | CDF family zinc efflux transporter CzrB | - |
QPR37_RS05900 (QPR37_05900) | 1229311..1229631 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
QPR37_RS05905 (QPR37_05905) | 1229783..1230448 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T282992 WP_001802298.1 NZ_CP126631:1226366-1226470 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT282992 NZ_CP126631:c1226645-1226466 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTCAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTCAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|