Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2737808..2738385 Replicon chromosome
Accession NZ_CP126629
Organism Staphylococcus aureus strain 35-42

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QPL68_RS13415 Protein ID WP_063651046.1
Coordinates 2737808..2738062 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QPL68_RS13425 Protein ID WP_000028426.1
Coordinates 2738212..2738385 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPL68_RS13350 (QPL68_13350) 2732862..2733623 + 762 WP_063651054.1 AP2 domain-containing protein -
QPL68_RS13355 (QPL68_13355) 2733616..2734377 + 762 WP_113583937.1 conserved phage C-terminal domain-containing protein -
QPL68_RS13360 (QPL68_13360) 2734390..2735175 + 786 WP_285146562.1 ATP-binding protein -
QPL68_RS13365 (QPL68_13365) 2735172..2735331 + 160 Protein_2592 hypothetical protein -
QPL68_RS13370 (QPL68_13370) 2735344..2735565 + 222 WP_001123684.1 DUF3269 family protein -
QPL68_RS13375 (QPL68_13375) 2735576..2735980 + 405 WP_259378785.1 DUF1064 domain-containing protein -
QPL68_RS13380 (QPL68_13380) 2735985..2736170 + 186 WP_063651049.1 DUF3113 family protein -
QPL68_RS13385 (QPL68_13385) 2736171..2736439 + 269 Protein_2596 helix-turn-helix transcriptional regulator -
QPL68_RS13390 (QPL68_13390) 2736440..2736799 + 360 WP_063651048.1 SA1788 family PVL leukocidin-associated protein -
QPL68_RS13395 (QPL68_13395) 2736799..2737056 + 258 WP_000111490.1 DUF3310 domain-containing protein -
QPL68_RS13400 (QPL68_13400) 2737059..2737259 + 201 WP_015984498.1 hypothetical protein -
QPL68_RS13405 (QPL68_13405) 2737268..2737516 + 249 WP_072437343.1 SAV1978 family virulence-associated passenger protein -
QPL68_RS13410 (QPL68_13410) 2737531..2737815 + 285 WP_078316597.1 hypothetical protein -
QPL68_RS13415 (QPL68_13415) 2737808..2738062 + 255 WP_063651046.1 DUF1024 family protein Toxin
QPL68_RS13420 (QPL68_13420) 2738049..2738222 + 174 WP_063651045.1 hypothetical protein -
QPL68_RS13425 (QPL68_13425) 2738212..2738385 + 174 WP_000028426.1 hypothetical protein Antitoxin
QPL68_RS13430 (QPL68_13430) 2738386..2738667 + 282 WP_063651044.1 hypothetical protein -
QPL68_RS13435 (QPL68_13435) 2738668..2738829 + 162 WP_000889682.1 hypothetical protein -
QPL68_RS13440 (QPL68_13440) 2738844..2739380 + 537 WP_259378787.1 dUTPase -
QPL68_RS13445 (QPL68_13445) 2739417..2739617 + 201 WP_063651040.1 hypothetical protein -
QPL68_RS13450 (QPL68_13450) 2739617..2739811 + 195 WP_063651038.1 DUF1381 domain-containing protein -
QPL68_RS13455 (QPL68_13455) 2739824..2739991 + 168 WP_154445040.1 hypothetical protein -
QPL68_RS13460 (QPL68_13460) 2740012..2740398 + 387 WP_063651037.1 hypothetical protein -
QPL68_RS13465 (QPL68_13465) 2740395..2740544 + 150 WP_000595265.1 transcriptional activator RinB -
QPL68_RS13470 (QPL68_13470) 2740544..2740744 + 201 WP_000265041.1 DUF1514 family protein -
QPL68_RS13475 (QPL68_13475) 2740767..2741237 + 471 WP_076749280.1 hypothetical protein -
QPL68_RS13480 (QPL68_13480) 2741352..2741804 + 453 WP_063651034.1 nucleoside triphosphate pyrophosphohydrolase family protein -
QPL68_RS13485 (QPL68_13485) 2741820..2742164 + 345 WP_000817289.1 HNH endonuclease -
QPL68_RS13490 (QPL68_13490) 2742294..2742761 + 468 WP_000919026.1 phage terminase small subunit P27 family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2724034..2742761 18727


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9483.48 Da        Isoelectric Point: 3.8928

>T282989 WP_063651046.1 NZ_CP126629:2737808-2738062 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKARAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEKI

Download         Length: 255 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6496.35 Da        Isoelectric Point: 4.4262

>AT282989 WP_000028426.1 NZ_CP126629:2738212-2738385 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVRLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References