Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 107913..108093 | Replicon | chromosome |
| Accession | NZ_CP126629 | ||
| Organism | Staphylococcus aureus strain 35-42 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | QPL68_RS00695 | Protein ID | WP_001801861.1 |
| Coordinates | 107998..108093 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 107913..107970 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL68_RS00675 (QPL68_00675) | 106261..106638 | + | 378 | WP_063651591.1 | DUF1433 domain-containing protein | - |
| QPL68_RS00680 (QPL68_00680) | 106764..107267 | - | 504 | Protein_98 | polysaccharide lyase beta-sandwich domain-containing protein | - |
| QPL68_RS00685 (QPL68_00685) | 107626..107781 | - | 156 | WP_174834634.1 | hypothetical protein | - |
| QPL68_RS00690 (QPL68_00690) | 107777..107875 | - | 99 | Protein_100 | hypothetical protein | - |
| - | 107913..107970 | + | 58 | - | - | Antitoxin |
| QPL68_RS00695 (QPL68_00695) | 107998..108093 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| QPL68_RS00700 (QPL68_00700) | 108252..108879 | + | 628 | Protein_102 | ImmA/IrrE family metallo-endopeptidase | - |
| QPL68_RS00705 (QPL68_00705) | 109077..109649 | - | 573 | WP_063651584.1 | hypothetical protein | - |
| QPL68_RS00710 (QPL68_00710) | 109750..110091 | - | 342 | WP_141060399.1 | DUF3969 family protein | - |
| QPL68_RS00715 (QPL68_00715) | 110132..110758 | - | 627 | WP_063651579.1 | hypothetical protein | - |
| QPL68_RS00720 (QPL68_00720) | 110834..111829 | - | 996 | WP_141060398.1 | DUF4352 domain-containing protein | - |
| QPL68_RS00725 (QPL68_00725) | 111911..112561 | - | 651 | WP_078316641.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD / hysA | 80203..113319 | 33116 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T282980 WP_001801861.1 NZ_CP126629:c108093-107998 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T282980 NZ_CP126629:c108093-107998 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT282980 NZ_CP126629:107913-107970 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|