Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2456830..2457014 | Replicon | chromosome |
Accession | NZ_CP126627 | ||
Organism | Staphylococcus aureus strain 17-21 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | QPR40_RS12240 | Protein ID | WP_000482647.1 |
Coordinates | 2456907..2457014 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2456830..2456890 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPR40_RS12225 (QPR40_12225) | 2452284..2452451 | - | 168 | WP_001790576.1 | hypothetical protein | - |
QPR40_RS12230 (QPR40_12230) | 2452682..2454415 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
QPR40_RS12235 (QPR40_12235) | 2454440..2456203 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein | - |
- | 2456830..2456890 | + | 61 | - | - | Antitoxin |
QPR40_RS12240 (QPR40_12240) | 2456907..2457014 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QPR40_RS12245 (QPR40_12245) | 2457148..2457534 | - | 387 | WP_000779360.1 | flippase GtxA | - |
QPR40_RS12250 (QPR40_12250) | 2457792..2458934 | + | 1143 | WP_285144360.1 | glycerate kinase | - |
QPR40_RS12255 (QPR40_12255) | 2458994..2459653 | + | 660 | WP_285144362.1 | hypothetical protein | - |
QPR40_RS12260 (QPR40_12260) | 2459835..2461046 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
QPR40_RS12265 (QPR40_12265) | 2461169..2461642 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T282975 WP_000482647.1 NZ_CP126627:c2457014-2456907 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT282975 NZ_CP126627:2456830-2456890 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|