Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4746302..4746891 | Replicon | chromosome |
Accession | NZ_CP126568 | ||
Organism | Xanthomonas oryzae pv. oryzicola strain HB8 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A0C5V8F2 |
Locus tag | QPJ94_RS21680 | Protein ID | WP_024712137.1 |
Coordinates | 4746302..4746583 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QPJ94_RS21685 | Protein ID | WP_011260746.1 |
Coordinates | 4746601..4746891 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPJ94_RS21675 | 4743946..4746207 | + | 2262 | WP_024712136.1 | exodeoxyribonuclease V subunit alpha | - |
QPJ94_RS21680 | 4746302..4746583 | + | 282 | WP_024712137.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QPJ94_RS21685 | 4746601..4746891 | + | 291 | WP_011260746.1 | HigA family addiction module antitoxin | Antitoxin |
QPJ94_RS21690 | 4747829..4749223 | + | 1395 | WP_149621925.1 | type III secretion system effector XopQ | - |
QPJ94_RS21695 | 4749326..4749513 | - | 188 | Protein_4116 | hypothetical protein | - |
QPJ94_RS21700 | 4749674..4750006 | - | 333 | WP_011260743.1 | hypothetical protein | - |
QPJ94_RS21705 | 4750261..4750566 | + | 306 | WP_224229802.1 | hypothetical protein | - |
QPJ94_RS21710 | 4750716..4751138 | + | 423 | WP_044751863.1 | PAAR domain-containing protein | - |
QPJ94_RS21715 | 4751141..4751617 | + | 477 | WP_024712141.1 | DUF4123 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11125.91 Da Isoelectric Point: 10.5318
>T282967 WP_024712137.1 NZ_CP126568:4746302-4746583 [Xanthomonas oryzae pv. oryzicola]
MIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYNIRINDQWRICFRWM
EGDVVQVEIVDYH
MIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYNIRINDQWRICFRWM
EGDVVQVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|