Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13607..14264 Replicon plasmid pblaNDM5-S1
Accession NZ_CP126537
Organism Citrobacter freundii strain CRNMS1

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag QOK75_RS26525 Protein ID WP_000270043.1
Coordinates 13914..14264 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QOK75_RS26520 Protein ID WP_000124640.1
Coordinates 13607..13909 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOK75_RS26470 (QOK75_26470) 9232..9660 + 429 WP_000591074.1 hypothetical protein -
QOK75_RS26475 (QOK75_26475) 9717..10076 + 360 WP_000422768.1 hypothetical protein -
QOK75_RS26480 (QOK75_26480) 10076..10522 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
QOK75_RS26485 (QOK75_26485) 10519..11037 + 519 WP_000210756.1 nitrite reductase -
QOK75_RS26490 (QOK75_26490) 11037..11267 + 231 WP_000972663.1 hypothetical protein -
QOK75_RS26495 (QOK75_26495) 11254..12111 + 858 WP_001167032.1 hypothetical protein -
QOK75_RS26500 (QOK75_26500) 12137..12325 + 189 WP_001270411.1 hypothetical protein -
QOK75_RS26505 (QOK75_26505) 12342..12869 + 528 WP_001236377.1 thermonuclease family protein -
QOK75_RS26510 (QOK75_26510) 12927..13199 + 273 WP_001043047.1 HU family DNA-binding protein -
QOK75_RS26515 (QOK75_26515) 13287..13580 + 294 WP_001239997.1 chromosome segregation protein ParM -
QOK75_RS26520 (QOK75_26520) 13607..13909 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
QOK75_RS26525 (QOK75_26525) 13914..14264 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QOK75_RS26530 (QOK75_26530) 14427..14975 + 549 WP_001061574.1 transcriptional regulator -
QOK75_RS26535 (QOK75_26535) 15120..16328 + 1209 WP_001339197.1 IS4-like element ISVsa5 family transposase -
QOK75_RS26540 (QOK75_26540) 16654..16848 + 195 WP_000343597.1 hypothetical protein -
QOK75_RS26545 (QOK75_26545) 16859..17230 + 372 WP_000516916.1 hypothetical protein -
QOK75_RS26550 (QOK75_26550) 17223..17693 + 471 WP_001281821.1 hypothetical protein -
QOK75_RS26555 (QOK75_26555) 17708..18043 - 336 WP_000683476.1 hypothetical protein -
QOK75_RS26560 (QOK75_26560) 18140..18628 + 489 WP_001273096.1 DUF1643 domain-containing protein -
QOK75_RS26565 (QOK75_26565) 18631..19128 + 498 WP_000062185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / floR / aadA5 / qacE / sul1 / qnrA1 / blaNDM-5 - 1..197210 197210
- flank IS/Tn - - 15120..16328 1208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T282955 WP_000270043.1 NZ_CP126537:c14264-13914 [Citrobacter freundii]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT282955 WP_000124640.1 NZ_CP126537:c13909-13607 [Citrobacter freundii]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References