Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4814266..4814936 | Replicon | chromosome |
Accession | NZ_CP126536 | ||
Organism | Citrobacter freundii strain CRNMS1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QOK75_RS23845 | Protein ID | WP_134216415.1 |
Coordinates | 4814634..4814936 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QOK75_RS23840 | Protein ID | WP_046671375.1 |
Coordinates | 4814266..4814607 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOK75_RS23810 (4809807) | 4809807..4810565 | + | 759 | WP_003844769.1 | phosphonate C-P lyase system protein PhnK | - |
QOK75_RS23815 (4810655) | 4810655..4811335 | + | 681 | WP_134216417.1 | phosphonate C-P lyase system protein PhnL | - |
QOK75_RS23820 (4811332) | 4811332..4812468 | + | 1137 | WP_003031811.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
QOK75_RS23825 (4812471) | 4812471..4813025 | + | 555 | WP_003844764.1 | ribose 1,5-bisphosphokinase | - |
QOK75_RS23830 (4813012) | 4813012..4813446 | + | 435 | WP_003031809.1 | aminoalkylphosphonate N-acetyltransferase | - |
QOK75_RS23835 (4813455) | 4813455..4814213 | + | 759 | WP_134216416.1 | phosphonate metabolism protein PhnP | - |
QOK75_RS23840 (4814266) | 4814266..4814607 | - | 342 | WP_046671375.1 | HigA family addiction module antitoxin | Antitoxin |
QOK75_RS23845 (4814634) | 4814634..4814936 | - | 303 | WP_134216415.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOK75_RS23850 (4815092) | 4815092..4815421 | - | 330 | WP_003031807.1 | DDRRRQL repeat protein YjdP | - |
QOK75_RS23855 (4815491) | 4815491..4817755 | - | 2265 | WP_134216414.1 | hybrid sensor histidine kinase/response regulator | - |
QOK75_RS23860 (4817870) | 4817870..4819393 | + | 1524 | WP_003031804.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11835.48 Da Isoelectric Point: 9.9581
>T282952 WP_134216415.1 NZ_CP126536:c4814936-4814634 [Citrobacter freundii]
MSKSLNIRSFRDTWLEDFFERATSHRKILADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
MSKSLNIRSFRDTWLEDFFERATSHRKILADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|