Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 594124..594923 | Replicon | chromosome |
Accession | NZ_CP126348 | ||
Organism | Escherichia coli strain NN5 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | QN227_RS02900 | Protein ID | WP_000347273.1 |
Coordinates | 594124..594588 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QN227_RS02905 | Protein ID | WP_001307405.1 |
Coordinates | 594588..594923 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN227_RS02870 (589125) | 589125..589559 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QN227_RS02875 (589577) | 589577..590455 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QN227_RS02880 (590445) | 590445..591224 | - | 780 | WP_033557704.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QN227_RS02885 (591235) | 591235..591708 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QN227_RS02890 (591731) | 591731..593011 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QN227_RS02895 (593260) | 593260..594069 | + | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
QN227_RS02900 (594124) | 594124..594588 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QN227_RS02905 (594588) | 594588..594923 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QN227_RS02910 (595073) | 595073..596644 | - | 1572 | WP_033557705.1 | galactarate dehydratase | - |
QN227_RS02915 (597019) | 597019..598353 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
QN227_RS02920 (598369) | 598369..599139 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 594124..605912 | 11788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T282893 WP_000347273.1 NZ_CP126348:c594588-594124 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |