Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4587951..4588553 | Replicon | chromosome |
| Accession | NZ_CP126345 | ||
| Organism | Escherichia coli strain DX6 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QN223_RS22475 | Protein ID | WP_000897305.1 |
| Coordinates | 4588242..4588553 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QN223_RS22470 | Protein ID | WP_000356397.1 |
| Coordinates | 4587951..4588241 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN223_RS22445 (4583876) | 4583876..4584778 | + | 903 | WP_021580356.1 | formate dehydrogenase O subunit beta | - |
| QN223_RS22450 (4584775) | 4584775..4585410 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QN223_RS22455 (4585407) | 4585407..4586336 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QN223_RS22460 (4586666) | 4586666..4586908 | - | 243 | WP_001087409.1 | protein YiiF | - |
| QN223_RS22465 (4587128) | 4587128..4587346 | - | 219 | WP_141087839.1 | CopG family transcriptional regulator | - |
| QN223_RS22470 (4587951) | 4587951..4588241 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QN223_RS22475 (4588242) | 4588242..4588553 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QN223_RS22480 (4588782) | 4588782..4589690 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| QN223_RS22485 (4589754) | 4589754..4590695 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QN223_RS22490 (4590740) | 4590740..4591177 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QN223_RS22495 (4591174) | 4591174..4592046 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QN223_RS22500 (4592040) | 4592040..4592639 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| QN223_RS22505 (4592738) | 4592738..4593523 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T282889 WP_000897305.1 NZ_CP126345:c4588553-4588242 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|