Detailed information of TA system TA282883

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2713931..2714151
• Replicon: chromosome
• Accession: NZ_CP126345
• Organism: Escherichia coli strain DX6

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A8S7XT81
• Locus tag: QN223_RS13300
• Protein ID: WP_074147554.1
• Coordinates: 2714044..2714151 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2713931..2713997 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QN223_RS13275	2709210..2710604	-	1395	WP_039023412.1	inverse autotransporter invasin YchO	-
QN223_RS13280	2710789..2711142	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
QN223_RS13285	2711186..2711881	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
QN223_RS13290	2712039..2712269	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
QN223_RS13295	2712539..2713639	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	2713931..2713997	-	67	-	-	Antitoxin
QN223_RS13300	2714044..2714151	+	108	WP_074147554.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2714464..2714527	-	64	NuclAT_34	-	-
-	2714464..2714527	-	64	NuclAT_34	-	-
-	2714464..2714527	-	64	NuclAT_34	-	-
-	2714464..2714527	-	64	NuclAT_34	-	-
-	2714464..2714527	-	64	NuclAT_36	-	-
-	2714464..2714527	-	64	NuclAT_36	-	-
-	2714464..2714527	-	64	NuclAT_36	-	-
-	2714464..2714527	-	64	NuclAT_36	-	-
-	2714464..2714527	-	64	NuclAT_38	-	-
-	2714464..2714527	-	64	NuclAT_38	-	-
-	2714464..2714527	-	64	NuclAT_38	-	-
-	2714464..2714527	-	64	NuclAT_38	-	-
-	2714464..2714527	-	64	NuclAT_40	-	-
-	2714464..2714527	-	64	NuclAT_40	-	-
-	2714464..2714527	-	64	NuclAT_40	-	-
-	2714464..2714527	-	64	NuclAT_40	-	-
-	2714464..2714527	-	64	NuclAT_42	-	-
-	2714464..2714527	-	64	NuclAT_42	-	-
-	2714464..2714527	-	64	NuclAT_42	-	-
-	2714464..2714527	-	64	NuclAT_42	-	-
-	2714464..2714527	-	64	NuclAT_44	-	-
-	2714464..2714527	-	64	NuclAT_44	-	-
-	2714464..2714527	-	64	NuclAT_44	-	-
-	2714464..2714527	-	64	NuclAT_44	-	-
-	2714465..2714527	-	63	NuclAT_46	-	-
-	2714465..2714527	-	63	NuclAT_46	-	-
-	2714465..2714527	-	63	NuclAT_46	-	-
-	2714465..2714527	-	63	NuclAT_46	-	-
-	2714465..2714527	-	63	NuclAT_49	-	-
-	2714465..2714527	-	63	NuclAT_49	-	-
-	2714465..2714527	-	63	NuclAT_49	-	-
-	2714465..2714527	-	63	NuclAT_49	-	-
-	2714466..2714527	-	62	NuclAT_16	-	-
-	2714466..2714527	-	62	NuclAT_16	-	-
-	2714466..2714527	-	62	NuclAT_16	-	-
-	2714466..2714527	-	62	NuclAT_16	-	-
-	2714466..2714527	-	62	NuclAT_19	-	-
-	2714466..2714527	-	62	NuclAT_19	-	-
-	2714466..2714527	-	62	NuclAT_19	-	-
-	2714466..2714527	-	62	NuclAT_19	-	-
-	2714466..2714527	-	62	NuclAT_22	-	-
-	2714466..2714527	-	62	NuclAT_22	-	-
-	2714466..2714527	-	62	NuclAT_22	-	-
-	2714466..2714527	-	62	NuclAT_22	-	-
-	2714466..2714527	-	62	NuclAT_25	-	-
-	2714466..2714527	-	62	NuclAT_25	-	-
-	2714466..2714527	-	62	NuclAT_25	-	-
-	2714466..2714527	-	62	NuclAT_25	-	-
-	2714466..2714527	-	62	NuclAT_28	-	-
-	2714466..2714527	-	62	NuclAT_28	-	-
-	2714466..2714527	-	62	NuclAT_28	-	-
-	2714466..2714527	-	62	NuclAT_28	-	-
-	2714466..2714527	-	62	NuclAT_31	-	-
-	2714466..2714527	-	62	NuclAT_31	-	-
-	2714466..2714527	-	62	NuclAT_31	-	-
-	2714466..2714527	-	62	NuclAT_31	-	-
QN223_RS13305	2714580..2714687	+	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2715001..2715067	-	67	NuclAT_45	-	-
-	2715001..2715067	-	67	NuclAT_45	-	-
-	2715001..2715067	-	67	NuclAT_45	-	-
-	2715001..2715067	-	67	NuclAT_45	-	-
-	2715001..2715067	-	67	NuclAT_48	-	-
-	2715001..2715067	-	67	NuclAT_48	-	-
-	2715001..2715067	-	67	NuclAT_48	-	-
-	2715001..2715067	-	67	NuclAT_48	-	-
-	2715002..2715065	-	64	NuclAT_17	-	-
-	2715002..2715065	-	64	NuclAT_17	-	-
-	2715002..2715065	-	64	NuclAT_17	-	-
-	2715002..2715065	-	64	NuclAT_17	-	-
-	2715002..2715065	-	64	NuclAT_20	-	-
-	2715002..2715065	-	64	NuclAT_20	-	-
-	2715002..2715065	-	64	NuclAT_20	-	-
-	2715002..2715065	-	64	NuclAT_20	-	-
-	2715002..2715065	-	64	NuclAT_23	-	-
-	2715002..2715065	-	64	NuclAT_23	-	-
-	2715002..2715065	-	64	NuclAT_23	-	-
-	2715002..2715065	-	64	NuclAT_23	-	-
-	2715002..2715065	-	64	NuclAT_26	-	-
-	2715002..2715065	-	64	NuclAT_26	-	-
-	2715002..2715065	-	64	NuclAT_26	-	-
-	2715002..2715065	-	64	NuclAT_26	-	-
-	2715002..2715065	-	64	NuclAT_29	-	-
-	2715002..2715065	-	64	NuclAT_29	-	-
-	2715002..2715065	-	64	NuclAT_29	-	-
-	2715002..2715065	-	64	NuclAT_29	-	-
-	2715002..2715065	-	64	NuclAT_32	-	-
-	2715002..2715065	-	64	NuclAT_32	-	-
-	2715002..2715065	-	64	NuclAT_32	-	-
-	2715002..2715065	-	64	NuclAT_32	-	-
QN223_RS13310	2715115..2715222	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
QN223_RS13315	2715371..2716225	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
QN223_RS13320	2716261..2717070	-	810	WP_001257044.1	invasion regulator SirB1	-
QN223_RS13325	2717074..2717466	-	393	WP_000200378.1	invasion regulator SirB2	-
QN223_RS13330	2717463..2718296	-	834	WP_000456571.1	peptide chain release factor N(5)-glutamine methyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4031.79 Da
• Isoelectric Point: 11.4779

>T282883 WP_074147554.1 NZ_CP126345:2714044-2714151 [Escherichia coli]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT282883 NZ_CP126345:c2713997-2713931 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin