Detailed information of TA system TA282866

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 18499..18768
• Replicon: plasmid pDAX4A
• Accession: NZ_CP126344
• Organism: Escherichia coli strain DAX4

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QN220_RS22820
• Protein ID: WP_001372321.1
• Coordinates: 18643..18768 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	18499..18564 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QN220_RS22770	13500..13712	+	213	WP_074154109.1	hypothetical protein	-
QN220_RS22775	13652..13882	+	231	WP_001380705.1	hypothetical protein	-
QN220_RS22780	14123..14329	+	207	WP_000547968.1	hypothetical protein	-
QN220_RS22785	14355..14807	+	453	WP_000290842.1	single-stranded DNA-binding protein	-
QN220_RS22790	14869..15102	+	234	WP_063085740.1	DUF905 family protein	-
QN220_RS22795	15167..17125	+	1959	WP_063072993.1	ParB/RepB/Spo0J family partition protein	-
QN220_RS22800	17180..17614	+	435	WP_000845907.1	conjugation system SOS inhibitor PsiB	-
QN220_RS22805	17611..18373	+	763	Protein_27	plasmid SOS inhibition protein A	-
QN220_RS22810	18342..18530	-	189	WP_001299721.1	hypothetical protein	-
-	18342..18566	+	225	NuclAT_0	-	-
-	18342..18566	+	225	NuclAT_0	-	-
-	18342..18566	+	225	NuclAT_0	-	-
-	18342..18566	+	225	NuclAT_0	-	-
-	18499..18564	-	66	-	-	Antitoxin
QN220_RS22815	18552..18701	+	150	Protein_29	plasmid maintenance protein Mok	-
QN220_RS22820	18643..18768	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QN220_RS22825	18988..19218	+	231	WP_001426396.1	hypothetical protein	-
QN220_RS22830	19216..19389	-	174	Protein_32	hypothetical protein	-
QN220_RS22835	19591..20538	-	948	Protein_33	methyl-accepting chemotaxis protein	-
QN220_RS22840	20603..21307	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
QN220_RS22845	21313..21453	+	141	WP_001044210.1	hypothetical protein	-
QN220_RS22850	21939..22676	+	738	WP_001366550.1	recombinase family protein	-
QN220_RS22855	22673..22897	+	225	WP_000743213.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1A / tet(M) / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / qnrS2	pet	1..130224	130224

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T282866 WP_001372321.1 NZ_CP126344:18643-18768 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT282866 NZ_CP126344:c18564-18499 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin