Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3717805..3718499 Replicon chromosome
Accession NZ_CP126343
Organism Escherichia coli strain DAX4

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag QN220_RS17950 Protein ID WP_001263493.1
Coordinates 3717805..3718203 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag QN220_RS17955 Protein ID WP_000554757.1
Coordinates 3718206..3718499 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3713465) 3713465..3713545 - 81 NuclAT_10 - -
- (3713465) 3713465..3713545 - 81 NuclAT_10 - -
- (3713465) 3713465..3713545 - 81 NuclAT_10 - -
- (3713465) 3713465..3713545 - 81 NuclAT_10 - -
QN220_RS17920 (3712805) 3712805..3714049 - 1245 WP_000189541.1 esterase FrsA -
QN220_RS17925 (3714141) 3714141..3714599 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QN220_RS17930 (3714860) 3714860..3716317 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
QN220_RS17935 (3716374) 3716374..3716895 - 522 Protein_3513 peptide chain release factor H -
QN220_RS17940 (3716894) 3716894..3717097 - 204 Protein_3514 RtcB family protein -
QN220_RS17945 (3717343) 3717343..3717795 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
QN220_RS17950 (3717805) 3717805..3718203 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QN220_RS17955 (3718206) 3718206..3718499 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QN220_RS17960 (3718551) 3718551..3719606 - 1056 WP_001226164.1 DNA polymerase IV -
QN220_RS17965 (3719677) 3719677..3720462 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
QN220_RS17970 (3720434) 3720434..3722146 + 1713 Protein_3520 flagellar biosynthesis protein FlhA -
QN220_RS17975 (3722370) 3722370..3722867 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 3716843..3733108 16265


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T282862 WP_001263493.1 NZ_CP126343:c3718203-3717805 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT282862 WP_000554757.1 NZ_CP126343:c3718499-3718206 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References