Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2442101..2442739 | Replicon | chromosome |
Accession | NZ_CP126343 | ||
Organism | Escherichia coli strain DAX4 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QN220_RS11750 | Protein ID | WP_000813794.1 |
Coordinates | 2442563..2442739 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QN220_RS11745 | Protein ID | WP_001270286.1 |
Coordinates | 2442101..2442517 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN220_RS11725 (2437253) | 2437253..2438194 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
QN220_RS11730 (2438195) | 2438195..2439208 | - | 1014 | WP_153443618.1 | ABC transporter ATP-binding protein | - |
QN220_RS11735 (2439226) | 2439226..2440371 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QN220_RS11740 (2440616) | 2440616..2442022 | - | 1407 | WP_153443619.1 | PLP-dependent aminotransferase family protein | - |
QN220_RS11745 (2442101) | 2442101..2442517 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QN220_RS11750 (2442563) | 2442563..2442739 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QN220_RS11755 (2442961) | 2442961..2443191 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QN220_RS11760 (2443283) | 2443283..2445244 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QN220_RS11765 (2445317) | 2445317..2445853 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QN220_RS11770 (2445945) | 2445945..2447120 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2447160..2448308 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T282859 WP_000813794.1 NZ_CP126343:c2442739-2442563 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT282859 WP_001270286.1 NZ_CP126343:c2442517-2442101 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|